Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endoge_x005fnous Mediator (LEM), Mononuclear Cell Factor (MCF)

Measure by its ability to induce proliferation in D10.G4.1 cells.
The ED50 for this effect is <10 pg/mL.
The specific activity of recombinant human IL-1 beta is approximately >1.5 x 108 IU/mg.
Measure by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is 1.8-5.1 ng/mL.

Interleukin 1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. There are two genes for interleukin-1 (IL-1): IL-1 alpha and IL-1 beta (this gene). IL-1β precursor is cleaved by cytosolic caspase 1 (interleukin 1 beta convertase) to form mature IL-1β.

P01584.2

3553

MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.

His-tag at the C-terminus

Human

Human

Escherichia coli

E. coli

>98% as determined by SDS-PAGE. Ni-NTA chromatography

<0.1 EU per 1 μg of the protein by the LAL method.

18.48 kDa

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Blue Ice

Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months.

Cytokines

Cell culture, Elisa