Monocyte Chemotactic Protein-1,MCP-1,JE

Measure by its ability to chemoattract BaF3 cells transfected with CCR2A.
The ED50 for this effect is <8 ng/mL.

CCL2, also known as MCP-1, is belonging to the CC chemokine family. CCL2 can be identified in endothelial cells, smooth muscle cells and monocytes as the results of reaction to several atherogenic stimulants, such as CD40 ligand, (IL-1β) and oxidized low density lipoprotein , interleukin-1βplatelet derived growth factor (PDGF). Recent study shows that in vivo MCP1 have several critical roles in atherosclerosis. Additionally, MCP-1 has been proved involving in monocytic infiltration of tissues during several inflammatory diseases, and has been implicated in macrophage-mediated tumor growth inhibition in mice. In addition, CCL2 has been shown to have direct effects on tumor cells in an autocrine and paracrine fashion in multiple cancers, including sarcoma, lung, cervix, ovary, breast, and prostate.

Q5SVU3

20296

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus.

His-tag at the N-terminus

Mouse

Mouse

Escherichia coli

E. coli

>98% as determined by SDS-PAGE. Ni-NTA chromatography

<0.1 EU per 1 μg of the protein by the LAL method.

14.65 kDa

The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Blue Ice

Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months.

Cytokines

Cell culture, Elisa