Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor . Core component of the 7SK RNP complex: in cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation . May also regulate NF-kappa-B, ESR1, NR3C1 and CIITA-dependent transcriptional activity . Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway . .

Protein HEXIM1 (Cardiac lineage protein 1) (Estrogen down-regulated gene 1 protein) (Hexamethylene bis-acetamide-inducible protein 1) (Menage a quatre protein 1),HEXIM1 CLP1 EDG1 HIS1 MAQ1

o94992

Mouse

Monoclonal

IgG2a

WGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLL

Human

IHC

IHC 1:100-1:200

Supplied as solution in phosphate buffered saline containing 0.09% sodium azide

Store at +4°C short term. Store at -20°C long term. Avoid freeze / thaw cycle.