Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions . Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC) and is also essential for the LBRC membrane to be targeted around migrating leukocytes . Trans-homophilic interaction may play a role in endothelial cell-cell adhesion via cell junctions . Heterophilic interaction with CD177 plays a role in transendothelial migration of neutrophils . Homophilic ligation of PECAM1 prevents macrophage-mediated phagocytosis of neighboring viable leukocytes by transmitting a detachment signal . Promotes macrophage-mediated phagocytosis of apoptotic leukocytes by tethering them to the phagocytic cells; PECAM1-mediated detachment signal appears to be disabled in apoptotic leukocytes . Modulates bradykinin receptor BDKRB2 activation . Regulates bradykinin- and hyperosmotic shock-induced ERK1/2 activation in endothelial cells . Induces susceptibility to atherosclerosis (By similarity). .; [Isoform Delta15]: Does not protect against apoptosis. .

Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA'') (PECA1) (CD antigen CD31),PECAM1

p16284

Mouse

Monoclonal

IgG3

KQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAES

Human

IHC

IHC 1:100

Supplied as solution in phosphate buffered saline containing 0.09% sodium azide

Store at +4°C short term. Store at -20°C long term. Avoid freeze / thaw cycle.