Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells . Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines . Also involved in activation of mast cells, basophils, eosinophils and natural killer cells . Acts as an enhancer of polarization of alternatively activated macrophages . Acts as a chemoattractant for Th2 cells, and may function as an ''alarmin'', that amplifies immune responses during tissue injury . Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity). .; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets . This form is rapidely lost upon angiogenic or pro-inflammatory activation . .

Interleukin-33 (IL-33) (Interleukin-1 family member 11) (IL-1F11) (Nuclear factor from high endothelial venules) (NF-HEV) [Cleaved into: Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33 (109-270)],IL33 C9orf26 IL1F11 NFHEV

o95760

Mouse

Monoclonal

IgG1

DQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEK

Human

ELISA

Sandwich ELISA 1:250-1:500

Supplied as solution in phosphate buffered saline containing 0.09% sodium azide

Store at +4°C short term. Store at -20°C long term. Avoid freeze / thaw cycle.