E3 ubiquitin-protein ligase involved in different protein quality control pathways in the cytoplasm and nucleus . Mainly acts as a ubiquitin chain elongator that extends pre-ubiquitinated substrates . Component of the N-end rule pathway: ubiquitinates proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their degradation (By similarity). Recognizes type-1 N-degrons, containing positively charged amino acids (Arg, Lys and His) (By similarity). Together with UBR4, part of a cytoplasm protein quality control pathway that prevents protein aggregation by catalyzing assembly of heterotypic ''Lys-11''-/''Lys-48''-linked branched ubiquitin chains on aggregated proteins, leading to substrate recognition by the segregase p97/VCP and degradation by the proteasome: UBR5 is probably branching multiple ''Lys-48''-linked chains of substrates initially modified with mixed conjugates by UBR4 . Together with ITCH, catalyzes ''Lys-48''-/''Lys-63''-branched ubiquitination of TXNIP, leading to its degradation: UBR5 mediates branching of ''Lys-48''-linked chains of substrates initially modified with ''Lys-63''-linked conjugates by ITCH . Catalytic component of a nuclear protein quality control pathway that mediates ubiquitination and degradation of unpaired transcription factors (i.e. transcription factors that are not assembled into functional multiprotein complexes): specifically recognizes and binds degrons that are not accessible when transcription regulators are associated with their coactivators . Ubiquitinates various unpaired transcription regulator (MYC, SUPT4H1, SUPT5H, CDC20 and MCRS1), as well as ligand-bound nuclear receptors (ESR1, NR1H3, NR3C1, PGR, RARA, RXRA AND VDR) that are not associated with their nuclear receptor coactivators (NCOAs) . Involved in maturation and/or transcriptional regulation of mRNA by mediating polyubiquitination and activation of CDK9 . Also acts as a regulator of DNA damage response by acting as a suppressor of RNF168, an E3 ubiquitin-protein ligase that promotes accumulation of ''Lys-63''-linked histone H2A and H2AX at DNA damage sites, thereby acting as a guard against excessive spreading of ubiquitinated chromatin at damaged chromosomes . Regulates DNA topoisomerase II binding protein (TopBP1) in the DNA damage response . Ubiquitinates acetylated PCK1 . Acts as a positive regulator of the canonical Wnt signaling pathway by mediating (1) ubiquitination and stabilization of CTNNB1, and (2) ''Lys-48''-linked ubiquitination and degradation of TLE3 . Promotes disassembly of the mitotic checkpoint complex (MCC) from the APC/C complex by catalyzing ubiquitination of BUB1B, BUB3 and CDC20 . Plays an essential role in extraembryonic development (By similarity). Required for the maintenance of skeletal tissue homeostasis by acting as an inhibitor of hedgehog (HH) signaling (By similarity). .

E3 ubiquitin-protein ligase UBR5 (EC 2.3.2.26) (E3 ubiquitin-protein ligase, HECT domain-containing 1) (Hyperplastic discs protein homolog) (hHYD) (Progestin-induced protein),UBR5 EDD EDD1 HYD KIAA0896

o95071

Mouse

Monoclonal

IgG2a

EHENDDDTNQSATLNDKDDDSLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSASSGKCLMEVTVDRNCLEVLPTKMSYAANLKNVMNMQNRQKKEGEEQPVLPEETESSKPGPS

Human

IHC

IHC 1:200

Supplied as solution in phosphate buffered saline containing 0.09% sodium azide

Store at +4°C short term. Store at -20°C long term. Avoid freeze / thaw cycle.