Catalyzes the ATP-dependent unwinding of RNA duplexes with a single-stranded 3'' RNA extension . Central subunit of many protein complexes, namely TRAMP-like, nuclear exosome targeting (NEXT) and poly(A) tail exosome targeting (PAXT) . NEXT functions as an RNA exosome cofactor that directs a subset of non-coding short-lived RNAs for exosomal degradation. NEXT is involved in surveillance and turnover of aberrant transcripts and non-coding RNAs . PAXT directs a subset of long and polyadenylated poly(A) RNAs for exosomal degradation. The RNA exosome is fundamental for the degradation of RNA in eukaryotic nuclei. Substrate targeting is facilitated by its cofactor ZCCHC8, which links to RNA-binding protein adapters . Associated with the RNA exosome complex and involved in the 3''-processing of the 7S pre-RNA to the mature 5.8S rRNA . May be involved in pre-mRNA splicing. In the context of NEXT complex can also in vitro unwind DNA:RNA heteroduplexes with a 3'' poly (A) RNA tracking strand . Can promote unwinding and degradation of structured RNA substrates when associated with the nuclear exosome and its cofactors. Can displace a DNA strand while translocating on RNA to ultimately degrade the RNA within a DNA/RNA heteroduplex . Plays a role in DNA damage response .

Exosome RNA helicase MTR4 (EC 3.6.4.13) (ATP-dependent RNA helicase DOB1) (ATP-dependent RNA helicase SKIV2L2) (Superkiller viralicidic activity 2-like 2) (TRAMP-like complex helicase),MTREX DOB1 KIAA0052 MTR4 SKIV2L2

p42285

23517

Human

WB,IHC,IF,ICC

WB 1:3000-1:4000
IHC 1:200
IF 1:100-1:400
ICC 1:100-1:400

AGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGC

Mouse

Monoclonal

IgG1

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Store at -20°C. Do not aliquot the antibody