Thiol protease that plays a key role in programmed cell death by acting as a molecular switch for apoptosis, necroptosis and pyroptosis, and is required to prevent tissue damage during embryonic development and adulthood . Initiator protease that induces extrinsic apoptosis by mediating cleavage and activation of effector caspases responsible for FAS/CD95-mediated and TNFRSF1A-induced cell death . Cleaves and activates effector caspases CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10 . Binding to the adapter molecule FADD recruits it to either receptor FAS/TNFRSF6 or TNFRSF1A . The resulting aggregate called the death-inducing signaling complex (DISC) performs CASP8 proteolytic activation . The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases . Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC . In addition to extrinsic apoptosis, also acts as a negative regulator of necroptosis: acts by cleaving RIPK1 at ''Asp-324'', which is crucial to inhibit RIPK1 kinase activity, limiting TNF-induced apoptosis, necroptosis and inflammatory response . Also able to initiate pyroptosis by mediating cleavage and activation of gasdermin-C and -D (GSDMC and GSDMD, respectively): gasdermin cleavage promotes release of the N-terminal moiety that binds to membranes and forms pores, triggering pyroptosis . Initiates pyroptosis following inactivation of MAP3K7/TAK1 (By similarity). Also acts as a regulator of innate immunity by mediating cleavage and inactivation of N4BP1 downstream of TLR3 or TLR4, thereby promoting cytokine production (By similarity). May participate in the Granzyme B (GZMB) cell death pathways . Cleaves PARP1 and PARP2 . Independent of its protease activity, promotes cell migration following phosphorylation at Tyr-380 .; [Isoform 5]: Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.; [Isoform 6]: Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.; [Isoform 7]: Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex (Probable). Acts as an inhibitor of the caspase cascade .; [Isoform 8]: Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.

Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10],CASP8 MCH5

q14790

841

Human

WB

WB 1:1000

TTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQF

Mouse

Monoclonal

IgG1

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Store at -20°C. Do not aliquot the antibody