Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3''-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs . CFIm contributes to the recruitment of multiprotein complexes on specific sequences on the pre-mRNA 3''-end, so called cleavage and polyadenylation signals (pA signals) . Most pre-mRNAs contain multiple pA signals, resulting in alternative cleavage and polyadenylation (APA) producing mRNAs with variable 3''-end formation . The CFIm complex acts as a key regulator of cleavage and polyadenylation site choice during APA through its binding to 5''-UGUA-3'' elements localized in the 3''-untranslated region (UTR) for a huge number of pre-mRNAs . CPSF6 enhances NUDT21/CPSF5 binding to 5''-UGUA-3'' elements localized upstream of pA signals and promotes RNA looping, and hence activates directly the mRNA 3''-processing machinery . Plays a role in mRNA export .; (Microbial infection) Binds HIV-1 capsid-nucleocapsid (HIV-1 CA-NC) complexes and might thereby promote the integration of the virus in the nucleus of dividing cells (in vitro).

Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre-mRNA cleavage factor Im 68 kDa subunit) (Protein HPBRII-4/7),CPSF6 CFIM68

q16630

11052

Human

IP

IP 1:100

EAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGA

Mouse

Monoclonal

IgG2b

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Store at -20°C. Do not aliquot the antibody