Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2 . The C-terminal domain of FBXL5 contains a redox-sensitive [2Fe-2S] cluster that, upon oxidation, promotes binding to IRP2 to effect its oxygen-dependent degradation . Under iron deficiency conditions, the N-terminal hemerythrin-like (Hr) region, which contains a diiron metal center, cannot bind iron and undergoes conformational changes that destabilize the FBXL5 protein and cause its ubiquitination and degradation . When intracellular iron levels start rising, the Hr region is stabilized . Additional increases in iron levels facilitate the assembly and incorporation of a redox active [2Fe-2S] cluster in the C-terminal domain . Only when oxygen level is high enough to maintain the cluster in its oxidized state can FBXL5 recruit IRP2 as a substrate for polyubiquination and degradation . Promotes ubiquitination and subsequent degradation of the dynactin complex component DCTN1 . Within the nucleus, promotes the ubiquitination of SNAI1; preventing its interaction with DNA and promoting its degradation . Negatively regulates DNA damage response by mediating the ubiquitin-proteasome degradation of the DNA repair protein NABP2 .

F-box/LRR-repeat protein 5 (F-box and leucine-rich repeat protein 5) (F-box protein FBL4/FBL5) (p45SKP2-like protein),FBXL5 FBL4 FBL5 FLR1

q9uka1

26234

Human

IHC,IF,ICC

IHC 1:100-1:200
IF 1:100-1:400
ICC 1:100-1:400

GPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEESAEESIAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQTDISD

Mouse

Monoclonal

IgG2b

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Store at -20°C. Do not aliquot the antibody