E3 ubiquitin-protein ligase involved in DNA damage response by promoting DNA resection and homologous recombination . Recruited to sites of double-strand breaks following DNA damage and specifically promotes double-strand break repair via homologous recombination . Two different, non-exclusive, mechanisms have been proposed. According to a report, regulates the choice of double-strand break repair by favoring homologous recombination over non-homologous end joining (NHEJ): acts by mediating ubiquitination of XRCC5/Ku80, leading to remove the Ku complex from DNA breaks, thereby promoting homologous recombination . According to another report, cooperates with UBE2Ds E2 ubiquitin ligases (UBE2D1, UBE2D2, UBE2D3 or UBE2D4) to promote homologous recombination by mediating ubiquitination of RBBP8/CtIP . Together with NLK, involved in the ubiquitination and degradation of TCF/LEF . Also exhibits auto-ubiquitination activity in combination with UBE2K . May act as a negative regulator in the Wnt/beta-catenin-mediated signaling pathway .

E3 ubiquitin-protein ligase RNF138 (EC 2.3.2.27) (Nemo-like kinase-associated RING finger protein) (NLK-associated RING finger protein) (hNARF) (RING finger protein 138) (RING-type E3 ubiquitin transferase RNF138),RNF138 NARF HSD-4 HSD4

q8wvd3

51444

Human

WB

WB 1:1000

HYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNH

Mouse

Monoclonal

IgG2a

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Store at -20°C. Do not aliquot the antibody