Component of the 17S U2 SnRNP complex of the spliceosome, a large ribonucleoprotein complex that removes introns from transcribed pre-mRNAs . The 17S U2 SnRNP complex (1) directly participates in early spliceosome assembly and (2) mediates recognition of the intron branch site during pre-mRNA splicing by promoting the selection of the pre-mRNA branch-site adenosine, the nucleophile for the first step of splicing . Within the 17S U2 SnRNP complex, SF3A2 is part of the SF3A subcomplex that contributes to the assembly of the 17S U2 snRNP, and the subsequent assembly of the pre-spliceosome ''E'' complex and the pre-catalytic spliceosome ''A'' complex . Involved in pre-mRNA splicing as a component of pre-catalytic spliceosome ''B'' complexes, including the Bact complex . Interacts directly with the duplex formed by U2 snRNA and the intron .

Splicing factor 3A subunit 2 (SF3a66) (Spliceosome-associated protein 62) (SAP 62),SF3A2 SAP62

q15428

8175

Human

IHC,IF,ICC

IHC 1:200-1:250
IF 1:100-1:400
ICC 1:100-1:400

KEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF

Mouse

Monoclonal

IgG2a

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Store at -20°C. Do not aliquot the antibody